ELISA Recombinant Rat Androgen-dependent TFPI-regulating protein(Adtrp)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5M828 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTKTTTCLYHFVVLNWYIFLNYYIPQIGKDEEKLKEFHDGGRSKYLTLLNLLLQAVFFGV ACLDDVLKRVIGRKDIKFITYFRDLLFTTLAFPLSTFVFLVFWSLFHYDRSLVYPKGLDD FFPAWVNHAMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYIIRILWRYVQTGNW VYPVFASLSPLGIILFFSASYILSASLYLFGEKINHWKWGATVKPRMKKN Protein Names:Recommended name: Androgen-dependent TFPI-regµLating protein Alternative name(s): Liver regeneration-related protein LRRG140 Gene Names:Name:Adtrp ORF Names:Aa2-020 Expression Region:1-230 Sequence Info:fµLl length protein