ELISA Recombinant Xenopus tropicalis Probable signal peptidase complex subunit 2(spcs2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5M8Y1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAARGGKNGLLEKWKIDDKPVKIDKWDGSAVKNSLDDAAKKVLLEKYRYVENFCLIDGRL IICTISCVFAIVALVWDYLHPFPESKPVLAICVISYFLMMGILTIYTSYKEKSIFLVAHR KDPAGMDPDDIWHLSSSLKRFDDKYTLKVTYISGKTKAQRDAEFTKSIARFFDDNGTLVM DLFEPEVSKLHDSLAMEKKTK Protein Names:Recommended name: Probable signal peptidase complex subunit 2 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 25 kDa subunit Short name= SPase 25 kDa subunit Gene Names:Name:spcs2 Expression Region:1-201 Sequence Info:fµLl length protein