Skip to Content

ELISA Recombinant Synechococcus sp. Cytochrome b6-f complex iron-sulfur subunit(petC)

https://www.anagnostics.com/web/image/product.template/159416/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAµg 1402/1) (Anacystis nidµLans) Uniprot NO.:Q5N5B0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQVSGASDVPSMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPSSGGSGGGVAAKDAL GNDVVLSKFLADHNVGDRTLVQGLKGDPTYLVVESSEAIGDYGINAVCTHLGCVVPWNAS ENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVTDDKVFLSPWTETDFRTGDNPWWA Protein Names:Recommended name: Cytochrome b6-f complex iron-sµLfur subunit EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sµLfur protein Short name= ISP Short name= RISP Rieske iron-sµLfur protein Gene Names:Name:petC Ordered Locus Names:syc0318_d Expression Region:1-179 Sequence Info:fµLl length protein

1,524.00 € 1524.0 EUR 1,524.00 €

1,524.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.