ELISA Recombinant Rhodobacter sphaeroides UPF0093 membrane protein RHOS4_28450(RHOS4_28450)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q53229 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRMADHFEETTMGTFLADYYLWTKSLHVISVLAWMAGLFYLPRLFVYHAEVVKAGTETDA LFQTMERRLLRAIMNPAMIATWIFGLLLVFTPGIVDWSmLWPWTKAACVLAMTGFHMWLA ARRRDFAAGANRHKGRTYRMMNELPTLLmLVIVFSAVAKWNYWGF Protein Names:Recommended name: UPF0093 membrane protein RHOS4_28450 Alternative name(s): ORF1 Gene Names:Ordered Locus Names:RHOS4_28450 ORF Names:RSP_1232 Expression Region:1-165 Sequence Info:fµLl length protein