ELISA Recombinant Xenopus laevis Protein FAM210A(fam210a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5M7E0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHLLRTLLLRSNTSNISLLTKCSFRASPLHKWPISLRSGSQISLLPTEQKKWLHSQPKQQ DTATKTPVHDLPSGIQHQSEETSPSARSSISTDPSSIAEEDPLQDQSIGLLKRFKKTFRQ HGKVLIPVHLVTSSIWFGSFYYAAMQGVNVVPFLEYIGLPDGIVNILKNSQGGNALTAYA MYKIATPARYTVTLGGTSVSVKYLRKYGYLSTPPLVKDYFQDRMEETKELFTEKMEETRD IISGKMEETKDRISEKLQETKDRVAFRKKKNEDME Protein Names:Recommended name: Protein FAM210A Gene Names:Name:fam210a Expression Region:1-275 Sequence Info:fµLl length protein