ELISA Recombinant Zymomonas mobilis Large-conductance mechanosensitive channel(mscL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zymomonas mobilis (strain ATCC 31821 / ZM4 / CP4) Uniprot NO.:Q5NNP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSILTDFKNFISKGNVLGLGIAVIMGDAFNKIISSVTGDLLMPIIGAVFGGVDFSGFFIR LGAVPAGYTGSLTSYNDLKKAGVPLFGYGQFLTVVVNFVIVAFILFMIMKLAAKLQKELD KTEAKKEEKIAEAAPTPEDIVLLREIRDELRGKK Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:ZMO1044 Expression Region:1-154 Sequence Info:fµLl length protein