ELISA Recombinant Solanum demissum CASP-like protein SDM1_58t00016(SDM1_58t00016)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Solanum demissum (Wild potato) Uniprot NO.:Q5NRN4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKAVSIEAGEGSKAKRVHGVNRGISVFDLVLRIVALVGTLASAVAMGTADQALSFSTQIV NFEAQYDDIDAFKFFVVSNSITCVYLALSIPISIFHIIRSRAGKSRVLLIVLDAImLVFL TSGASAAAAIVYLAHNGNTSTNWFSICQQYTDFCQRSAGSLIGSFGAMALMVLLIILSSI ALSRR Protein Names:Recommended name: CASP-like protein SDM1_58t00016 Gene Names:ORF Names:SDM1_58t00016 Expression Region:1-185 Sequence Info:fµLl length protein