Skip to Content

ELISA Recombinant Ustilago maydis 3-ketoacyl-CoA reductase(UM04441)

https://www.anagnostics.com/web/image/product.template/160362/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q4P622 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAIEQHIDGLLRHVGLRVDHGLTPVSASLVLLAGIGALSVGTFALRLVRLFADVYILPGN SVSKYGANKKDLTRASWAVVTGATDGIGREFALQLARKGFNIVLVSRSPEKLGSVAAEIE AATPGVRTKTQAIDFALGDERQYEGLEHTVKGLNVGVLVNNVGKSHNMPVTFTETSEEEM EDIIEINVVSVLRVSKMIIPGMVDRKRGLVLNLGSFAGQVTTPmLATYAGSKAFLSGWSQ ALGEEVKRSNVDVSLLNTYFVVSNLSKIRKSSAMIPTPKQYVTQVLKTLGRNGGAVGRPY TATPWPGHALVDWATTFVLPRGWLLSYTYGQQVATRKRALNKAHKAVKSA Protein Names:Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase Gene Names:ORF Names:UM04441 Expression Region:1-350 Sequence Info:fµLl length protein

1,704.00 € 1704.0 EUR 1,704.00 €

1,704.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.