ELISA Recombinant Staphylococcus sp. Quaternary ammonium compound-resistance protein qacC(qacC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus sp. (strain ST827) Uniprot NO.:Q55339 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPYIYLIISISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQHLPLNITYA TWAGLGLVLTTVVSIIIFKEQINLITIVSIVLIIVGVVSLNIFGTSH Protein Names:Recommended name: Quaternary ammonium compound-resistance protein qacC Alternative name(s): Quaternary ammonium determinant C Gene Names:Name:qacC Expression Region:1-107 Sequence Info:fµLl length protein