ELISA Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 7(nqo7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) Uniprot NO.:Q56217 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVH FYVVAmLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH Protein Names:Recommended name: NADH-quinone oxidoreductase subunit 7 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I chain 7 NDH-1 subunit 7 Gene Names:Name:nqo7 Ordered Locus Names:TTHA0084 Expression Region:1-119 Sequence Info:fµLl length protein