ELISA Recombinant Salmonella choleraesuis Spermidine export protein MdtI(mdtI)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella choleraesuis (strain SC-B67) Uniprot NO.:Q57PF4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQQFEWIHGAWLGLAImLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA Protein Names:Recommended name: Spermidine export protein MdtI Gene Names:Name:mdtI Ordered Locus Names:SCH_1501 Expression Region:1-109 Sequence Info:fµLl length protein