ELISA Recombinant Salmonella choleraesuis Putative 2-aminoethylphosphonate transport system permease protein phnV(phnV)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella choleraesuis (strain SC-B67) Uniprot NO.:Q57SD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPIWSPKGRAAAGVVASVLFIVFFFLPLAVILMSSLSQQWNGILPSGFTLNHFVNALHGA AWDALLASLTIGFCASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGI LVAFSQGPLQMNGTLWIVLTAHFVLISAFTFSNVSTGLARISADIENVASSLGASPWYRL RHVTLPLLMPWMMSALALSLSLSMGELGATMMIYPPGWTTLPVAIFSLTDRGNIADGAAL TIVLVAITLLLMMKLERIAKWLGQK Protein Names:Recommended name: Putative 2-aminoethylphosphonate transport system permease protein phnV Gene Names:Name:phnV Ordered Locus Names:SCH_0467 Expression Region:1-265 Sequence Info:fµLl length protein