ELISA Recombinant Staphylococcus aureus UPF0382 membrane protein SACOL0629(SACOL0629)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus aureus (strain COL) Uniprot NO.:Q5HI93 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWImLIIATFKF AG Protein Names:Recommended name: UPF0382 membrane protein SACOL0629 Gene Names:Ordered Locus Names:SACOL0629 Expression Region:1-122 Sequence Info:fµLl length protein