ELISA Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4(petD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAµg 1402/1) (Anacystis nidµLans) Uniprot NO.:Q5N160 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPA LVGEPADPFATPLEILPEWYLYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKF QNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGLF Protein Names:Recommended name: Cytochrome b6-f complex subunit 4 Alternative name(s): 17 kDa polypeptide Gene Names:Name:petD Ordered Locus Names:syc1770_c Expression Region:1-160 Sequence Info:fµLl length protein