ELISA Recombinant Rickettsia felis Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi) Uniprot NO.:Q4UKR6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDTEDNKNKQTTRRDFMVLTASSVAAVGAVCTLWPLVDSLNPSADVLALSSIEVDLSNI AVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPETDEARVKAGHDNWLVTIGIC THLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISDKKIRIG Protein Names:Recommended name: Ubiquinol-cytochrome c reductase iron-sµLfur subunit EC= 1.10.2.2 Alternative name(s): Rieske iron-sµLfur protein Short name= RISP Gene Names:Name:petA Ordered Locus Names:RF_1010 Expression Region:1-177 Sequence Info:fµLl length protein