ELISA Recombinant Pseudomonas syringae pv. syringae Large-conductance mechanosensitive channel(mscL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. syringae (strain B728a) Uniprot NO.:Q4ZNG6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVLKEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPLGLLIGGVDFSDLAVT LRPAQGTAPAVLLAYGKFIQTVIDFIIVAFAIFMGVKAINRLKREEAKAPTLPPTPSKQE ILLGEIRDLLKEQSKPAAPITVDPARTL Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:Psyr_4276 Expression Region:1-148 Sequence Info:fµLl length protein