ELISA Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit F(phaF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Uniprot NO.:Q52983
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELAVVWSVLVAQTmLALAMAFALYRMARGPRAQDRILGLDTLYINAmLmLITFGIRTAN TVYFETALIIAVIGFASSIALAKFLMRGEVIE
Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit F Alternative name(s): pH adaptation potassium efflux system protein F Short name= Pha system subunit F
Gene Names:Name:phaF Synonyms:phaF1 Ordered Locus Names:R02914 ORF Names:SMc03183
Expression Region:1-92
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.