ELISA Recombinant Xanthomonas campestris pv. campestris Type 4 prepilin-like proteins leader peptide-processing enzyme(xpsO)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568) Uniprot NO.:Q56763 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFLDQHPGLGFPAAAGLGLLIGSFLNVVILRLPKRMEWQWRRDAREILELPDIYEPPPP GIVVEPSHDPVTGDKLKWWENIPLFSWLmLRGKSRYSGKPISIQYPLVELLTSILCVASV WRFGFGWQGFGAIVLSCFLVAMSGIDLRHKLLPDQLTLPLMWLGLVGSMDNLYMPAKPAL LGAAVGYVSLWTVWWLFKQLTGKEGMGHGDFKLLAALGAWCGLKGILPIILISSLVGAVL GSIWLFAKGRDRATPIPFGPYLAIAGWVVFFWGNDLVDGYLRFAGLR Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.- Gene Names:Name:xpsO Synonyms:pilD Ordered Locus Names:XCC3101 Expression Region:1-287 Sequence Info:fµLl length protein