ELISA Recombinant Xenopus laevis FUN14 domain-containing protein 1A(fundc1-a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q58EA0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAARREPSSDDESYEVLDLTDYARRHHWWNRLFGRNSGPLTEKYSVATQIVIGGVSGWCA GFLFQKVGKLAATAVGGGFLLLQIASHGGYIQVDWKRVEKDVNNAKRKIKKEANKSAPEI NTLIEESTDFVKKNIVVSGGFVGGFLLGLAS Protein Names:Recommended name: FUN14 domain-containing protein 1A Gene Names:Name:fundc1-a Expression Region:1-151 Sequence Info:fµLl length protein