ELISA Recombinant Staphylococcus epidermidis Holin-like protein CidB(cidB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Uniprot NO.:Q5HL71 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNEYLQAVLMILLTIVLYYVSKKIQDKYNNPLLNPALIASIAIIIVLLVCGVSYKGYMKG GTWINHVLNATVVCLAYPLYQNKKKIKKYLTIIFTSVLTGVVLNFVLVFTTLKIFGYSKD TIVTLLPRSITAAVGIEVSQELGGTDTITVLFIITTGLIGSILGSmLLRMGGFKSSIARG LTYGNASHAFGTAKALELDIESGAFSSIGMILTAVISSVLIPVLILLFY Protein Names:Recommended name: Holin-like protein CidB Gene Names:Name:cidB Ordered Locus Names:SERP2116 Expression Region:1-229 Sequence Info:fµLl length protein