ELISA Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3(ndhC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAµg 1402/1) (Anacystis nidµLans) Uniprot NO.:Q5N559 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKWNSDCSLEFGVFVLNGYEYLLGFLLISSLVPILSLTASRLLRPGRRGPERRTTYESG MEPIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFVEALIFITILVVG LAYAWRKGALEWS Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3 EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3 NDH-1 subunit 3 Short name= NDH-C Gene Names:Name:ndhC Ordered Locus Names:syc0370_c Expression Region:1-133 Sequence Info:fµLl length protein