ELISA Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit C(phaC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q52980 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MELILSAGIGTLTASGVYLLLRPRTYQVIIGLSLLSFAVNLFIFGMGRLRVNAPPILDPG GVGDLARYTDPVPQALVLTAIVIGFAMTALFLVVLLASRGFTGTDHVDGREQRGD Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit C Alternative name(s): pH adaptation potassium efflux system protein C Short name= Pha system subunit C Gene Names:Name:phaC Synonyms:phaC1 Ordered Locus Names:R02911 ORF Names:SMc03180 Expression Region:1-115 Sequence Info:fµLl length protein