ELISA Recombinant Rhizobium sp. Probable peptide ABC transporter permease protein y4tP(NGR_a01430)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium sp. (strain NGR234) Uniprot NO.:Q53191 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVYILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEP LPVQFVHWASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLA AWRSGGFVDRALATFSAIGYSVPVFVIGYILIYFFAIQTRWLPVQGYTSINQGVAPWFLH LILPTVTLSVPYIAFIARITRGSmLEVLSEDYMRTAAAKGASPFAmLFHHALKNAGVPIL TVIGISFAYMIGGVVLTETVFNVPGIGRLVVDAIKNRDYPIIQTVLVLISGLYVLINLLV DLAYTLIDPRIRY Protein Names:Recommended name: Probable peptide ABC transporter permease protein y4tP Gene Names:Ordered Locus Names:NGR_a01430 ORF Names:y4tP Expression Region:1-313 Sequence Info:fµLl length protein