ELISA Recombinant Synechocystis sp. Probable diacylglycerol kinase(dgkA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechocystis sp. (strain PCC 6803 / Kazusa)
Uniprot NO.:Q55143
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSVYPMSSPSSAVFADQGLSGKANQTQPPPPLGLVVPASKPGAKKPLRKNAWQVAPNLL VSFRYAWAGVSYAFATQRNFRIHTFTGVAVITAASLLHLEAIAVAVLALTSCLVMILELL NTALESVVDLTVGQSYHELAKIAKDCAAGAVLLAAIAAVIVGGCLLLPPLLSLMV
Protein Names:Recommended name: Probable diacylglycerol kinase Short name= DAGK EC= 2.7.1.107 Alternative name(s): Diglyceride kinase Short name= DGK
Gene Names:Name:dgkA Ordered Locus Names:slr0054
Expression Region:1-175
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.