ELISA Recombinant Synechocystis sp. Bicarbonate transport system permease protein CmpB(cmpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:Q55461 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTTISQRKNRAAGANPLQKFWRKRRGDILPPIFGILGFLLLWQLISSAGLIKLPPPSSL WTDPRTRTLLMYPFYDQGGLDKGLFWQTLASLGRVAQGYSLAAIVGISTGILVGTQPLLD KALDPIFQFLRMVAPLAWVPIALVALQQNQPAAIFVIFITSVWPILINTTEGVKQIPQDY INVRKVLRLSPQKFFFKILIPSALPYIFTGLRIAIGLAWLAIIAAEIVMSGIVGIGFFIW DAYQQNYISEIILAVFYIGAVGLLLDRGIAYLQKLIAPGQ Protein Names:Recommended name: Bicarbonate transport system permease protein CmpB Gene Names:Name:cmpB Ordered Locus Names:slr0041 Expression Region:1-280 Sequence Info:fµLl length protein