Skip to Content

ELISA Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhG2(mnhG2)

https://www.anagnostics.com/web/image/product.template/158752/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Uniprot NO.:Q5HRA6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEIIKDIVSLIASILIFLGSIIALISAIGIVKFQDVFLRSHASTKSSTLSVLLTVVGVLI YFIVNSGFFSVRLLLSLVFINLTSPVGMHLISRAAYRNGAYMYRKDDASRQSTILLSQKE FNTPEELKKRAKLREERREKLYYKEKEYINKMDD Protein Names:Recommended name: Putative antiporter subunit mnhG2 Alternative name(s): Mrp complex subunit G2 Putative NADH-ubiquinone oxidoreductase subunit mnhF2 Gene Names:Name:mnhG2 Synonyms:mrpG2 Ordered Locus Names:SERP0287 Expression Region:1-154 Sequence Info:fµLl length protein

1,498.00 € 1498.0 EUR 1,498.00 €

1,498.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.