ELISA Recombinant Rat CD320 antigen(Cd320)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5HZW5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRI EPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRC DGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNP NAYGVIAAAGVLSAILVSATILILLRLRGQGYLPPTGLLVAVKESLLLSERKTSLI Protein Names:Recommended name: CD320 antigen Alternative name(s): Transcobalamin receptor Short name= TCblR CD_antigen= CD320 Gene Names:Name:Cd320 Expression Region:29-264 Sequence Info:fµLl length protein