ELISA Recombinant Rat Vomeronasal type-1 receptor 52(Vmn1r52)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5J3G9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKDNTLYCSAYRIAFFSEIGIGISANSCLLLFHTFMFIRGHRPRLTDLPIGLVALIHLV mLLLAAYITEDFFMSSGGWDDITCKLFIFLHRFFRSLSVCDTCmLSVFQAIILCPQSSHL AKFKLNSPHHLSCFFIFMSIFYTSISSHILIAAIATQNLTSVNLIYITKSCSFLPMSSSM QRTFSTLLAFRNVFLIGLMGLSTCYMATLLCRHKTRSQQLQNSKLSPKATPEQRAIWTIL mLMSFFLIISTFDSIMTYSRTIFQGNQSLYCVQIPVAHGYAAFSPLLVLNNEKRLTSLMI SMYDRIVRLESLCS Protein Names:Recommended name: Vomeronasal type-1 receptor 52 Alternative name(s): Vomeronasal type-1 receptor A7 Gene Names:Name:Vmn1r52 Synonyms:V1ra7 Expression Region:1-314 Sequence Info:fµLl length protein