ELISA Recombinant Ustilago maydis NADH-cytochrome b5 reductase 2(MCR1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q4P7Y8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFIRPVLSSSLGHAARSSLRSQAPAVRQYATEAGKSSGGSNLPLVLALGGVAGIGAWYGL GGFDDPKKVSNKIQEKGKEAVDQAKGAVEGGALNKDQFVEFTLKEIKPYNHDSATLIFEL PEGKKPGMGVASAVVVKAVGDGLKDDQGKDVIRPYTPITSPDTVGHMDFLVKKYPGGKMT TYMHSMKPGDKLGIKGPIAKFAYKANEFESIGMIAGGSGITPMYQVIQDIASNPSDKTKV TLIYSNKTEQDILLREQFDQLAKKDDRFTIIYGLDKLPKGFNGFEGYVTEDLVKKHLPQP ELADKAKIFVCGPPPQVEAISGKKGPKGSQGELKGLLAKLGYQADQVYKF Protein Names:Recommended name: NADH-cytochrome b5 reductase 2 EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase Gene Names:Name:MCR1 ORF Names:UM03775 Expression Region:1-350 Sequence Info:fµLl length protein