ELISA Recombinant Tetraodon nigroviridis Probable glutathione peroxidase 8(gpx8)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) Uniprot NO.:Q4RSM6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEALGGYPTRSSNPKAKKLTVLLSMTVGVGCLLLLQTQLLKPRRPSDFYSFEVKDAKGRT VSLEKYRGKASLVVNVASRSEQTESNYRSLQELHRELGPSHFNVLAFPCAQFGETETGSS RDSEAFAKATYGVTFPFFSRIKIMGSEAEPAFRFLTDSVQKVPRWNFWKFLVNPEGKVVR FWRTDEPMESIRREVTALVREIILKKRVEL Protein Names:Recommended name: Probable glutathione peroxidase 8 Short name= GPx-8 Short name= GSHPx-8 EC= 1.11.1.9 Gene Names:Name:gpx8 ORF Names:GSTENG00029623001 Expression Region:1-210 Sequence Info:fµLl length protein