ELISA Recombinant Rat Taste receptor type 2 member 38(T2r38)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q4VHE7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLTLTPVLTVSYEAKISFLFLSVVEFAVGIMANAFIVLVNFWDMVKKQPLNNCDIALLCL SITRLFLQGLLLLDAIQLACFQQMKDPLSHNYQAILTLWMSANQVSLWLAACLSLLYCAK IVRFSHTFPLHLASWVSRRFLQmLLVALLFSGVCTALCLWDFFSRSHTVVTSmLHMNNTE FNLQIEKLNFFYSFVFCNVGSVPPSLVFLISSGVLVISLGNHMRTMKSQTRGSRDPSLEA HVRAIIFLVSFLCFYVVSFCAALISIPLLVLWHNKGGVMVCIGMMAACPSGHAAILISGN AKLKKVIVTILFWFQSRQKVRRVHKVLPRIL Protein Names:Recommended name: Taste receptor type 2 member 38 Short name= T2R38 Alternative name(s): Taste receptor type 2 member 26 Short name= T2R26 Gene Names:Name:T2r38 Synonyms:Tas2r26 Expression Region:1-331 Sequence Info:fµLl length protein