ELISA Recombinant Rhizobium meliloti Probable K(+)-H(+) antiporter subunit E(phaE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:Q52982 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRTWFPYPLLSIALLLMWLLLSQSVTPGSIVLGLVVSTVLAWVTLNLQPARSRLHRWSRI AGFILRVVGDVIRSNIAVTLIILRAGRRPVNAGFMTVSLDLDDENALALLACVVTATPGT AWLEYDRRQKILLFHVLDIENEDLWRKTITRYAADLKEIFE Protein Names:Recommended name: Probable K(+)/H(+) antiporter subunit E Alternative name(s): pH adaptation potassium efflux system protein E Short name= Pha system subunit E Gene Names:Name:phaE Synonyms:phaE1 Ordered Locus Names:R02913 ORF Names:SMc03182 Expression Region:1-161 Sequence Info:fµLl length protein