ELISA Recombinant Xenopus laevis Ribonuclease kappa-B(rnasek-b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q566G2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSLLCCGPKLAACGIVLSVWGVImLVLLGVFFNVHSAVLIEDVPFTEADMFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR Protein Names:Recommended name: Ribonuclease kappa-B Short name= RNase K-B Short name= RNase kappa-B EC= 3.1.-.- Gene Names:Name:rnasek-b Expression Region:1-101 Sequence Info:fµLl length protein