ELISA Recombinant Vibrio fischeri Electron transport complex protein RnfG(rnfG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio fischeri (strain ATCC 700601 / ES114) Uniprot NO.:Q5E6C0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLTTMKKSSLVLALFAIAATALVTITYALTKDQIAYQQQQQLLSVLNQVVPKEQHDNELY KACVLVKNKDALGSKQAMPIYLASLNGQHSGAAIEAIAPDGYSGNIKIIVGVDSDAMVTG VRVLSHQETPGLGDKIDIRITRWVDGFLGKTVENAEDKNWAVQKDGGQFDQFTGATITPR AVVKAVKRAVWFYKTHQEELQTLPLNCETK Protein Names:Recommended name: Electron transport complex protein RnfG Gene Names:Name:rnfG Ordered Locus Names:VF_0931 Expression Region:1-210 Sequence Info:fµLl length protein