ELISA Recombinant Xenopus tropicalis DNA damage-regulated autophagy modulator protein 1(dram1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5EAK8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPCWCLHGAAFLPSILVIWSSAGFLFSYIISVLIGHVPPFVPYISDTGTSPPESGVFGFM ISLSAmLGAATMYTRYKILEKQNHSTDFLPYYFNKTSLAIGLLGCIGMGIVATFQEMAVP AVHDAGALITFICGVLYILLQSYISYKSCPAWNTRVTCHIRMAISVIAFIAVVPMSVFSV LSGRKRLDWKPSDEGYHYHLTSAICEWIVAFGFNMYFLTFIRDFQGVSIQISTEIHEDF Protein Names:Recommended name: DNA damage-regµLated autophagy modµLator protein 1 Alternative name(s): Damage-regµLated autophagy modµLator Gene Names:Name:dram1 Synonyms:dram Expression Region:1-239 Sequence Info:fµLl length protein