ELISA Recombinant Staphylococcus epidermidis Na(+)-H(+) antiporter subunit G1(mnhG1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Uniprot NO.:Q5HQL6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIATIVTSVSIIFVVLGALISAFAATGLIRLRDVYSRAHAAGKAATLGAMFLLFGAFLYF IGTEGYVNMQLIIGIIFVFITGPLSSHLIMKAAYNIKTPYTKDTKIDEIKEDMKHTKL Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1 Gene Names:Name:mnhG1 Ordered Locus Names:SERP0532 Expression Region:1-118 Sequence Info:fµLl length protein