ELISA Recombinant Rat Vomeronasal type-1 receptor B6(V1rb6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5J3N1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNKDNTLHTIMKITMFSEVSVGISANSILFFAHLCmLLGENRPKPFHLYIVSLSLTQLIL LITMGLIAVDMFMSWGRWDSTPCQSLIYLHRLLRGFTLCAACLLNVFWMITLSPRSSCLS KFKHNSPHHISGAFLFLCVLYMSFSSHLLVSIIATPNLTSNIFMYVTQSCSLLPMSYSRT STFSTTIAIREAFLISLMALSSGFMVTLLWRHKKQAQHLHSTSLSSKASPERRATRTILL LMSFFVVLYILENVVFYSRMKFKDGSMFYCVQIIVSHSYATISPFVFICTEKHMTKILRS VCTRIINI Protein Names:Recommended name: Vomeronasal type-1 receptor B6 Alternative name(s): M24 pheromone receptor Gene Names:Name:V1rb6 Expression Region:1-308 Sequence Info:fµLl length protein