ELISA Recombinant Poinsettia latent virus Genome-linked protein precursor(ORF2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Poinsettia latent virus (isolate Euphorbia pµLcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus) Uniprot NO.:Q5NDN0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TTNVRGNLYNDEGFRLSVGEDDKAEHWTDRLMKSITFKTKRWADWAEEESESDDERGKVV PPAKPSNYGEGCPPEHNQYLSDVGDLLTKVIGPEQNEKCVDILMGIMGVDKNEVAPHKEE KAEKGNEAVVSATVKTVKEPTTQCDEDIISEIVKRVVDKMNLKAIEKSVVEILAEKAMTK APRGKRKNSKDTSRPSTPGSYIIPAKRTPDSGPVEKSLNSTGRAKEESPSGARTLPGNIP AWVR Protein Names:Recommended name: Genome-linked protein precursor Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg Gene Names:ORF Names:ORF2 Expression Region:417-660 Sequence Info:fµLl length protein