ELISA Recombinant Ustilago maydis Protein YOP1(YOP1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q4P0H0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAQAQQIQQKVEYFVAQIDKELSRYPALKKFEQTVPVPKAYAALGAFGIFTLFVFFNIA AGFLTNLLGFFVPAYFSLKALESPQPQDDIQWLTYWVVFGLFTFLETFINIVLYYIPWYY TIKTLAIVWLmLPQTQGAKMVYSRIIRPVFLTTQKTVHQANASTPAAPAETH Protein Names:Recommended name: Protein YOP1 Gene Names:Name:YOP1 ORF Names:UM06393 Expression Region:1-172 Sequence Info:fµLl length protein