ELISA Recombinant Ustilago maydis Presequence translocated-associated motor subunit PAM17, mitochondrial(PAM17)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:Q4P983 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SSSSSSNRGTFSPTSPILFSASSSSSSSSSPSSSRELSHLSWDKYLQLRRSRRLAGMVTT IPTTLLAGAAAGSYFLTLELDPTNAIAGLDPVYINAGLTLACTGLGWLIGPTVGNSIWGL LHRSDAKQIAQKDHDFYEHIKRNRVDPTRQSVQNPVPDYYGEKIGSIKQYRQWLRDQAAF RRKAAHGLEQDA Protein Names:Recommended name: Presequence translocated-associated motor subunit PAM17, mitochondrial Gene Names:Name:PAM17 ORF Names:UM03330 Expression Region:41-232 Sequence Info:fµLl length protein