ELISA Recombinant Xenopus laevis Vacuolar ATPase assembly integral membrane protein VMA21(vma21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q4V7U1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERYDKAALNAADVPPPSFSQNGGSLVSTLKTLLFFTILMImLPIGLYFSSKVYVFEGTY GMSNRDSYFYAAIVAVVAVHVVLAMFVYVAWNEGSPQWREGKQD Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21 Gene Names:Name:vma21 Expression Region:1-104 Sequence Info:fµLl length protein