ELISA Recombinant Ralstonia solanacearum Hypersensitivity response secretion protein hrcR(hrcR)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum) Uniprot NO.:Q52488 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQNVEFASLIVMAVAIALLPFAAMVVTSYTKIVVVLGLLRNALGVQQVPPNMVLNGIAMI VSCFVMAPVGMEAMQRAHVQINAQGGTNITQVMPLLDAARDPFREFLNKHTNAREKAFFM RSAQQLWPPAKAAQLKDDDLIVLAPAFTLTELTSAFRIGFLLYLAFIVIDLVIANLLMAL GLSQVTPSNVAIPFKLLLFVVMDGWSVLIHGLVNTYR Protein Names:Recommended name: Hypersensitivity response secretion protein hrcR Gene Names:Name:hrcR Synonyms:hrpT Ordered Locus Names:RSp0860 ORF Names:RS01631 Expression Region:1-217 Sequence Info:fµLl length protein