ELISA Recombinant Shewanella putrefaciens Mercuric transport protein(merT)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shewanella putrefaciens (Pseudomonas putrefaciens) Uniprot NO.:Q54462 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKSNPNFPIIGGVIAAIGAGLCCAGPFVLLLLGVSGSWIGNLTLLEPYRPIFILLVLAL FGFAGWKVYRPVEDCEPGTSCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA Protein Names:Recommended name: Mercuric transport protein Alternative name(s): Mercury ion transport protein Gene Names:Name:merT Expression Region:1-115 Sequence Info:fµLl length protein