ELISA Recombinant Rat DNA damage-regulated autophagy modulator protein 2(Dram2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5BK09 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTMPPERCLFGVmL NIAAVLGIATIYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSALFIV HVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSIL YSSDFGADIVQKLHWNPEDKGYVLHIVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEAN LHGLTLYDTVPCPVTNERTPLLSRDFQ Protein Names:Recommended name: DNA damage-regµLated autophagy modµLator protein 2 Alternative name(s): Transmembrane protein 77 Gene Names:Name:Dram2 Synonyms:Tmem77 Expression Region:1-267 Sequence Info:fµLl length protein