ELISA Recombinant Pyrococcus kodakaraensis UPF0290 protein TK2119(TK2119)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Thermococcus kodakaraensis (strain KOD1)) Uniprot NO.:Q5JEX0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGWLSSIFWAFWYILPAYFANASPVLVGGGRPIDGGRVWRDGRRLLGDGKTWRGFIGGVL IGTLVGIVQYFITPDFYGSLETAVKLAFLLSFGALIGDLVGSFIKRRANLPRGYPAIGLD QLGFLISALAFAYPVKTLSSGQIIFLLVVSPFIHWGANYFAYRMGWKSVPW Protein Names:Recommended name: UPF0290 protein TK2119 Gene Names:Ordered Locus Names:TK2119 Expression Region:1-171 Sequence Info:fµLl length protein