ELISA Recombinant Silicibacter pomeroyi Cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Uniprot NO.:Q5LNI0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTALLLGFAmLLDAALGEPEWLWSRLRHPAVLIGDIISVLDDELNEGGHRRLKGVAVTA ILAVGALSVGALLSLLGPVAEVLICAILLAQKSLAGHVADVADALRLSLPEARRSVARIV SRDTATMSEPQVARAAIESAAENLSDGVIAPAFWFLVGGLPGLLLYKTINTADSMVGYMN ERYAQFGWAAARLDDLLNLIPARLTCGMIVLLSNGWRHWRGIVEDAQRHISPNAGWPEAA MARALNIALAGPRSYHGEIRHLAWVNEEGRKEIGPREIERAVTLLWQVWALALGLTLTLV ALAAIF Protein Names:Recommended name: Cobalamin biosynthesis protein CobD Gene Names:Name:cobD Ordered Locus Names:SPO3225 Expression Region:1-306 Sequence Info:fµLl length protein