ELISA Recombinant Streptococcus thermophilus UPF0397 protein stu0306-stu0307(stu0306-stu0307)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) Uniprot NO.:Q5M5Y6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNNSIRTVVATGIGAALFIIICIFVNIPIFGNTSIQLQYAVQVLFSVIFGSRSIIGFFM GFIGQVLKDGIQYGDISWAWVLASGITGLVIGLFGKKYDVTMGKFSVMSMIWFNLAQALG LLIAYGVVTPIGDKIQFAQAWSYLYAQSFVAGVANFITIAIGGTLLLAIYASSRTQSGSL TKG Protein Names:Recommended name: UPF0397 protein stu0306/stu0307 Gene Names:Ordered Locus Names:stu0306/stu0307 Expression Region:1-183 Sequence Info:fµLl length protein