ELISA Recombinant Xenopus tropicalis Elongation of very long chain fatty acids protein 5(elovl5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5M8U1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEVLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYLFIVWRGPKYMQNRPPVS CRGILVVYNLGLTLLSLYMFYELVTGVWEGGYNFFCQDTNSGGDADTKIVRVLWWYYFSK LIEFMDTFFFILRKNNHQITVLHVYHHASmLNIWWFVMNWVPCGHSYFGATLNSFIHVLM YSYYGLSAIPAMRPYLWWKKYITQCQLTQFVLTMTQTTCAMIWPCKFPMGWLYFQNCYMI SLIILFGNFYIKTYNKKTSSRRKEYQNGSASAVNGHTNSFSSLEDNVKQRKQRQD Protein Names:Recommended name: Elongation of very long chain fatty acids protein 5 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase Elovl5 ELOVL fatty acid elongase 5 Short name= ELOVL FA elongase 5 Gene Names:Name:elovl5 Expression Region:1-295 Sequence Info:fµLl length protein