ELISA Recombinant Rat Protein FAM162A(Fam162a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q4QQV3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWSLRGLRLAAGHCFRLCERNVSSPLRLTRNTDLKRINGFCTKPQESPKAPTQSYRHRVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEmLDAAKNKIRVKVSYLMIALTVAGCVYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKAD Protein Names:Recommended name: Protein FAM162A Alternative name(s): E2-induced gene 5 protein homolog Gene Names:Name:Fam162a Synonyms:E2ig5 Expression Region:1-155 Sequence Info:fµLl length protein