ELISA Recombinant Xanthomonas campestris pv. campestris Undecaprenyl-diphosphatase(uppP)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. campestris (strain 8004) Uniprot NO.:Q4V093 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIVIQAGAILAICLALRQ KLWTLATGLGERANRDYVLKIGVAFLVTAVVGLIVRKAGWQLPETIQPVAWALLIGGVWM LVAEHFAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSASAIFLAmLLGLSKRSAAAD FVFMVGIPTMFAASGYALLEMYKEGGFGSENWTDVSVAFIAATLTGFVVVKWLLGYIKKH RFTVFAVYRILLGAALLLWLPAA Protein Names:Recommended name: Undecaprenyl-diphosphatase EC= 3.6.1.27 Alternative name(s): Bacitracin resistance protein Undecaprenyl pyrophosphate phosphatase Gene Names:Name:uppP Ordered Locus Names:XC_0193 Expression Region:1-263 Sequence Info:fµLl length protein